PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678413169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YA
Protein Properties Length: 307aa    MW: 34544.9 Da    PI: 10.3567
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678413169genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA53.86.5e-17148182136
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 
                d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rk
  678413169 148 DGPIYVNAKQYHGILRRRQTRAKLEAQNKL-VKARK 182
                57****************************.66666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-8146202IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.588147182IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-12150182IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860152172IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTVHHTKSAF ELKRCNRCFS KYRRQIAKVF LAEDPVYRKL KYSSFKQPKL PNMQKKTSHD  60
HCGSSDSAPD ERYGKDGQDM KGAFFLGNPE IFVNSSSAEA NQPMFQHSYS DPHFNGVLAS  120
YGAQNVIQPH MMSGAFGRVP LPPGLPEDGP IYVNAKQYHG ILRRRQTRAK LEAQNKLVKA  180
RKTPTLCAAL PPRVPASACP QQRNQTAAVK EELKVEAMAP FTMGTGITPP RLSVEKQSFL  240
RCRRGWATHP WLCRLIIQVH GCVRMLLCEA EKRLLGLPQG ADPLNRKMDE QQQHPALVFS  300
PVTRLTP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.22e-23nuclear factor Y, subunit A3